Skip to main content

Table 3 Group and sub-group specific conserved motifs

From: Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families

Motifa Multilevel consensus sequenceb
1 CPRCDSTNTKFCYYNNYSLSQPRHFCKACRRYWTKGGALRNVPVGGGCRK c
2 KGEGCLWVPKTLRIDDPDEAAKSSIWTTLGIK
3 DDPGIKLFGKTIPF
4 KALKKPDKILP
5 LQANPAALSRSQNFQE
6 PMDRLAFGDESFEQDYYDVGSDDLIVNPLIGGS
7 KRAKIDQPSVAQMVSVEIQPGNHQPFFNVQENNDFVGSF
8 MDNLNVFANEDNQVNDVKPPP
9 SPTLGKHSRDE
10 YHMNPVDQFKWNQSFNNAMNMNYNN
11 RVLWGFPWQM
12 ERKARPQKDQ
13 IDLALAYAKFLKHH
14 ATALKFASDSPLCESMASVLDIGEK
15 RLLFPFEDLKPLVS
16 HGGFRHDFPMKRLRC YSDGQSCd
17 MVFSSVPAYLD
18 FYPVPAYWGC
19 KNPKLLHEGAQDLNLAFPHH
20 GHVDQIDSGREIW
21 VAAVGNHFGSLSEIHG
22 MMDSNSVLYSSLGFPTMPDYK
23 CFPGVPWPYTW
24 FGHRFHGPVRPDMILEGM
25 INVKPMEEI
26 IESLSCFNQDLHQKLQQQR
27 YWSGMI
28 WTDLAMNRAEK
29 LEQWRLPQIQQFPFFHAMDAM
30 WGCFSGWPNGAWNAPWI
31 EAGRRPAPQFAGVDLRRPKGY
32 NKGWPSSDHYLHITSEDCDN
33 HAAPIPATWQFEGLE
34 MELLRSTGCYM
35 MHPCHLEK
36 PIEFLGLPGNLQFW
37 DEEAKYDPFDSFPDDALSLHDCI
  1. a Numbers correspond to the motifs described in Figure 3. b Sequences obtained from the analysis of the 66 rice and Arabidopsis Dof complete proteins with the MEME system. c Dof consensus sequence (in italics). d Predicted nuclear localization signal, according to Park et al [50] (underlined).