Skip to main content

Table 2 General Sequence of Alternative Splice Exons from all NCX Homologs

From: Gene Structure Evolution of the Na+-Ca2+ Exchanger (NCX) Family

Species NCX A B C D E F
Teleost 4all KLLNVKIIDDEEYEKNKTFTIVLEEPILLEVGQKH      
Amphibian 4 RFIEIQVIDDEEYEKNKNFYVELGEPEMQRSGKKS      
Reptile 4 KYIEIKIIDDEEYEKNKNFHLELGPPVLLDTGPRH      
Teleost 2all   QSFQVRIIDDEEYEKHENFFIVLEEPRWLKRGIS ALLLNQE    
Amphibian 2   KTLQVKIVDDEEYEKQENFFIILEEPRWMKRGIS ALLLNQG    
Reptile 2   KSLYVKIIDVEEYEKKDSFFIELGQPRWLKRGIS ALLLNQD    
Mammals 2   KTLQVKIVDDEEYEKKDNFFIELGQPQWLKRGIS ALLLNQG    
Teleost 3 KFIHVKIIDDEEYEKNKNFFLELAEPRMVDMSLQK      
Amphibian 3 KTIQIKIFDDEEYEKNKTFFIELREPHLVDLSVQK KTIRVKIIDEEEYERQESFFIALGEPKWMKRGIS ALLLNQG    
Reptile 3 KTVHIKVIDDEEYEKNKTFFIELMPPRMVDMSLHK KTIRVKIVDEEEYERQENFFIALGEPKWMERGIS AILLNQL    
Aves 3 KTIHIKVIDDEEYEKNKSFFIELMSPRMVDMSLQK      
Mammals 3 KTIHIKVIDDEAYEKNKNYFIEMMGPRMVDMSFQK KTIRVKIVDEEEYERQENFFIALGEPKWMERGIS ALLLSPG   GKTSY  
Teleost 1 KTIQINIIDDEEYEKNKNFFLEIGEPQLLEMSERK KTIKVKILDHEEYDKHANFFIELQEPEWRRRGWT     
Amphibian 1 KIISVKIIDDEEYEKNKTFFLEVGEPRLVEMSEKK KCITLKILDREEYDKESNFFLVLQEPIWIRRGMK ALLLNEL GDFTIT GKILY GKPVLRKVQVRDHPIPSTVIILT
Reptile 1 KTISIKVIDDEEYEKNKTFYIEIGEPRLVEMSEKK KSITLRILDREEYEKECNFYLVLEEPIWIRRRTK ALLLNEL GGFTIT   GKPVYRKVHARDHPFPSTVINIQ
Aves 1 KTISIKVIDDEEYEKNKTFYLEIGEPRLVEMSEKK KFITLRILDREEYEKECSFFLVLGDPVWLRRGVK ALLLNEL GGFTIT GKLWK GKPVFRKVQARERPLPCTVVTIR
Mammals 1 KTISVKVIDDEEYEKNKTFFLEIGEPRLVEMSEKK KIITIRIFDREEYEKECSFSLVLEEPKWIRRGMK ALLLNEL GGFTIT GKYLF GQPVFRKVHAREHPILSTVITIA
Teleost exceptions
Pufferfish 1d KTIQVNIIDDEEYEKNKNFFIELGDPRLLEMSERK   ARLLQEV    GRDMYRKVQEWHPSAAMINIPGM
Medaka 1d KTIRINIIDDEEYEKNKNFFLEMGEPLLLEMSERK KTIALRIMDREEYDKKASFCVELQEPFWNSRWTG AVLLQEV    
Green pufferfish 1d   KSLHIRIVDDGEFGQDKNFLLELGEPRLLDPSQS     DRDVYRKLQGWNLPDAVINITGM
Trout 1d KSIQINIIDDEEYEKNKNFFLEMGEPQLLEMSERK   AVLLQEI GGFVKT   GRDVYRKVQGRDNPVPATIISLA
Tilapia 1d KTIRINIIDDEEYEKNKNFFLEIGEPRLLEMSERK   AVLLQEV GGFVKT   GRDIYRKVQGREHPVPSNIISIA
Dogfish 1 KTIEIKVIDDEEYEKNKNFFIEIGEPRLVEMSEKK   ALLLNEL GPFTKT AKYFN GHAIYRKVHFRDNPIPSTVICIA
Zebrafish 1d KTIQINIIDDEEYEKNKNFFLEIGEPQLVEMSERK   AMLLHEC GGFVKT DKQLY GRDVYRKVQGRDKPIPSTIISIS
Stickleback 1d KTIQINIIDDEEYEKNKNFFLEIGEPQLLEMSERK KTIAVRVIDRDEYDKQASFYIELQEPYRNQRRWT AVLLQEV GGFVKT   GRDVYRKVQGRDHPAPSAVISIT