Skip to main content

Table 3 Heterosigma akashiwo signal peptides

From: Chloroplast His-to-Asp signal transduction: a potential mechanism for plastid gene regulation in Heterosigma akashiwo (Raphidophyceae)

Precursor Protein Accession Number Signal peptide Beginning of STD
RpoD EF115377 VAHCTTFAYKGSNMRSHFFFMLWSVSVAATAA F MMPGR...
Fcp1 X99697 MSLKLATLAAALMGASA F VAPNKM...
Fcp2 EF115376 VVFDLYASTIPSVNQAHKSKMSLKLATFAAALAGASA F VAPNQM...
PRK EF115375 MMYKLATLLALLPAVVA F TTSFNG...
PsbO AY130990 MKFVAVLVCLMVSAVVA F KTQRN...
  1. Heterosigma akashiwo RNA polymerase D subunit (RpoD), fucoxanthin chlorophyll binding protein 1 (Fcp1), fucoxanthin chlorophyll binding protein 2 (Fcp2), phosphoribulose kinase (PRK), and 33 kDa oxygen-enhancer 1 protein (PsbO) precursors showing the signal peptide and the start of stromal targeting domain (STD). The conserved phenalynine (F) indicating the beginning of stromal targeting domain [62, 97, 98] is marked in bold.